Recombinant Cardiac Actin (ACTC1) Recombinant Human Protein

£250.00

41.79 kDa

Recombinant Human cardiac actin.

Fully functional.

Polymerises and depolymerises.

Activates ATPase activity of myosin.

Purity: >95%.

No Tags.

Sequence:

DDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF

Postranslational modifications:

Ethylation of N-terminus

Methylation of His73

Cardiac Actin (Alpha-Cardiac Actin, α-cardiac actin) is a specialized actin isoform primarily found in cardiac muscle cells (cardiomyocytes). It is encoded by the ACTC1 gene in humans and plays a crucial role in cardiac muscle contraction, forming the primary component of thin filaments in sarcomeres, where it interacts with myosin to generate force.


Key Functions of Cardiac Actin:

  1. Muscle Contraction: Forms thin filaments that interact with myosin to enable the contraction of cardiac muscle fibers.

  2. Sarcomere Structure: Maintains the structural integrity of cardiac muscle cells, essential for continuous heart function.

  3. Mechanical Stability: Helps withstand the constant mechanical stress experienced by the heart during each beat.

  4. Cell Signaling and Regulation: Participates in mechanotransduction, influencing gene expression in response to mechanical forces.


Structural Features:

  • Composed of 375 amino acids, with a molecular weight of ~42 kDa.

  • Found predominantly in cardiac muscle, though it is also expressed at lower levels in skeletal muscle during early development.

  • Exists in both monomeric (G-actin) and polymeric (F-actin) forms, dynamically assembling into filaments.


Cardiac Actin vs. Other Actin Isoforms:

Isoform

Expression

Primary Function

α-cardiac actin (ACTC1)

Cardiac muscle

Contraction of the heart muscle

α-skeletal actin (ACTA1)

Skeletal muscle

Voluntary muscle contraction

β-actin (ACTB)

Non-muscle cells

Cytoskeletal support, motility

γ-actin (ACTG1, ACTG2)

Non-muscle & smooth muscle

Structural support, stress fibers


Clinical Relevance:

  • Cardiomyopathies: Mutations in the ACTC1 gene are linked to familial hypertrophic cardiomyopathy (HCM) and dilated cardiomyopathy (DCM), conditions that affect heart function and structure.

  • Congenital Heart Defects: Some mutations can lead to structural abnormalities in the heart, impacting its ability to pump blood efficiently.

  • Muscle Disorders: Defects in α-cardiac actin may contribute to muscle weakness and reduced contractile force.


Importance in Research & Medicine:

  • Used as a biomarker for cardiac muscle function.

  • Studied for its role in heart regeneration and potential gene therapy approaches.

  • Targeted in cardiac drug development, aiming to improve heart function in patients with genetic mutations affecting contractility.

Contacts

orders@andexbiotech.com

Socials
Subscribe to our newsletter